SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105771 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105771
Domain Number 1 Region: 230-468
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-66
Family Nuclear receptor ligand-binding domain 0.0000000395
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105771   Gene: ENSDARG00000017780   Transcript: ENSDART00000122742
Sequence length 480
Comment pep:known chromosome:Zv9:2:49987900:50017464:1 gene:ENSDARG00000017780 transcript:ENSDART00000122742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQRHQQLSQDCLAGLTGRDEAEDG
AHSRPYSSGGSSSTLSDLDDIATLPDGLLFDLPLTPEEAGEYCALEMLSSGTGSGGSGSG
SSSSSQSSPEPSAVDLADAVRVKHEYIMPDNSRLTHSLLGSIPDNCSLHDIERITQNVVK
SHLETCQYSTEELKKHTWSLYTPEETRSFQLKSAEWMWQQCALQITNAIQYVVEFAKRIS
GFMELCQNDQIILLKAGCLEVLLIRMCRAYNSSNNTMFFDGKFASPQLFKALGCDDLVNA
VFELAKSLSRLQLSEEEMALYSAAVLLAPDRPWLTESQQVQKLQEKVYVALQHSLHMNGA
TIEKLDKMVSKLPQMKSICNLHIDKLEFFRLVHPETAYSFPPLYREVFGSEINFPDSTNS
Download sequence
Identical sequences B8JJ08
ENSDARP00000105771 NP_001264023.1.45394 ENSDARP00000105771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]