SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105792 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105792
Domain Number 1 Region: 539-689
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-64
Family Ankyrin repeat 0.00000662
Further Details:      
 
Domain Number 2 Region: 33-268,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.01e-60
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 421-537
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.03e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000889
Further Details:      
 
Domain Number 4 Region: 269-401
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-22
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 5 Region: 931-989
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000578
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105792   Gene: ENSDARG00000021896   Transcript: ENSDART00000130080
Sequence length 991
Comment pep:known chromosome:Zv9:17:27033011:27077487:-1 gene:ENSDARG00000021896 transcript:ENSDART00000130080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEKISISDFVSLAKEDLSSPGSSGFQSKMSDCRSTVAALEESLEQDQMSLQKMKKIVKA
IHNSGLNHVENKEQYTEVLENLGNSHLSQDNNEVSTGFLNLAVFTREVTALFKNLVQNLN
NIISFPLENVLKSELRDSRLELKKQMEKSWKDYDAKIGKLEKERREKQKQHGLIRLDMTD
TAEDMERERRNFQLQMCEYLLKIQELKIRQGPDLLQGLIKYFQAQLNFFQDGLKAAENLG
PFVEKLAASVHTVRHEQDEEVKQLSQLRDSLRTQLQVDGKEDFLNRKNSGHGYSIHQPQG
NKKYGTEKSGFLLKKSDGIRKVWQKRKCGVKYGCLTISHSTINRPPAKLNLLTCQVRPNP
EEKRTFDLVTHNRTYHFQAEDEQECMIWVSVLQNSKEEALNTALGGDQLQFQDSGLQELV
RAVISGLRNLPGNESCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHQSRIQSLTLDV
LSTSELLLAVSIGNARFNDIMEVNLPNDAVKPLPKSDMTARKEYIVAKYAERRYVLPKEH
SEAYRVFDTVRSKDLVSLLQHYAEGEDLSKPVAIPDGQDLKETGLHLAVRMSDKTSLALV
DFLAQNCGCLEKKTVEGNTALHYCALYKKTECLKLLLKAKAVLHTVNSAGETALDIAKRL
QHMQCIELLELAHSGKFNSQIHVEYTWEMPQDMYDSEDDLDERASPHPKVSRSPLPPTGV
NGHCSSAWNLNKSCPARTYENIDFLYRNPPNNSAPTGGHMPPPLPAKAIQRGRSDPQISG
SIPETHTPYRQSSHPTGCFQKISTTPPEPCGPTPARSHSTGPSKGQRQTVFWEGQPFSGA
EGKNHSTSPQSQRGPVSSEKTTSYRRTSGGSQGKGSAPSPGYAGSQEELYCSPASNPAPP
PANANNSVAVPVLLPPPRSRKNAMISLRERPKKVKALVDCRAVGANHLAFFKNEVIIVTA
TDDPHWWVGHIEGEPSRSGTFPVNYVHKLGE
Download sequence
Identical sequences F1QYT8
ENSDARP00000105792 ENSDARP00000105792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]