SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105986 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105986
Domain Number 1 Region: 83-94,181-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-52
Family Nuclear receptor ligand-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 11-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105986   Gene: ENSDARG00000018030   Transcript: ENSDART00000130361
Sequence length 447
Comment pep:known chromosome:Zv9:8:54781728:54803229:1 gene:ENSDARG00000018030 transcript:ENSDART00000130361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLWKYDQAEQRSCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCEMSRK
QRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISDEEIERIMSGQEFKDEAN
MPEHTWGNNGDSDHSSPGNGVSDGNQPSPVSTLSSNRSVELNGYTTALREQYIGNAMAQH
YQFLPHLFGYAAQPRSLYPQSHTLISQLVAAEDLAPLGTPMLIEDGYRVTQVELFALLCR
LADELLFRQISWIKKLPFFCDLSIEDYTRLLSATWQELILLACLTVYSAQVLGDLANVTH
KYTPSDDELHSFSEDGMEVMEKLIYLFRKFHQLKVSNEEYACMKAINFLNQDIRGLTNVT
QLEQLNKRYWYVCQDYTEYKYPHQPKRFPEIMMCLPEIRCIAGKLVNIPLEQLPLLFKAV
LHSCKSSLSSYRTSSSPCVTKGTAPAN
Download sequence
Identical sequences ENSDARP00000105986 ENSDARP00000105986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]