SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107150 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107150
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.15e-62
Family FCH domain 0.0025
Further Details:      
 
Domain Number 2 Region: 329-388
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-19
Family SH3-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107150   Gene: ENSDARG00000054645   Transcript: ENSDART00000124504
Sequence length 389
Comment pep:known chromosome:Zv9:3:30814610:30829821:-1 gene:ENSDARG00000054645 transcript:ENSDART00000124504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLPAESGPEDANNQSFWMPGNYHQTVKRTEDSFQACNDIVACFQERARVERQYAQQLS
EWSAKWKPLVDASPLYGSLLRAWQCFLSSADRLSSLHSSICRALVSEDGDRIRTWQKETF
HKKIFGGFKESQDFETGFSRAQKPWAKRLKKLEKARSAFHKACRKEHMARERETHAQGNP
DIAIEKQRKIQEETELAHQETEKVRARYEKVLEEVTRYAPRYMEEMESIFDQSQEEERKR
ISFLKQAFLSIHRHLDVTNNESVKAVYNELHDTLMSISEQEDLRWWKNTHGPGMPTDWPQ
FQEWTPDKKHKKGKKEVEQKAAVMERSVMIGGVRVRALYDYVGQETDELSFKAGEEFLKI
EDEDDQGWCRGMMDGGKEGLYPANYVEAV
Download sequence
Identical sequences F1R2D9
XP_021327115.1.45394 XP_697258.2.45394 ENSDARP00000107150 ENSDARP00000125640 ENSDARP00000107150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]