SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107246 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107246
Domain Number 1 Region: 201-469
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-74
Family Nuclear receptor ligand-binding domain 0.00000000443
Further Details:      
 
Domain Number 2 Region: 97-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.11e-27
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107246   Gene: ENSDARG00000031777   Transcript: ENSDART00000125361
Sequence length 470
Comment pep:known chromosome:Zv9:4:17677723:17703189:-1 gene:ENSDARG00000031777 transcript:ENSDART00000125361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDMPSLYSPSSPLGDPIMYSPLSGELIGDMQVLEDISQSLSDDTFNSFHMLDYQNCDTA
VDNSSILDVLTPASSPSSEVFSASTGQDENSSGSLTLECRVCADRASGFHYGVHACEGCK
GFFRRTIRLKLEYDKCERNCKIQKKNRNKCQYCRFRKCLAVGMSHNAIRFGRIPQSEKQR
LKAEQDVSGKEEHKCQQPDMRSLARQMHEAYLKHFHMNKAKARVFLTGKTSTPPFVIHDM
DTLQHAEKKLVTQLLGNVASGDISTLQEREVEARLFLFCQYASVATVTELTEYAKAVPGF
ADLDLNDQVTLLKYGVYEALFTLLASCMNKDGLLVAQGGGFITREFLKSLRKPFSDMMEP
KFQFAMKFNALELDDSDLALFVAAIICCGDRPGLSNVPQIERIQESVIHSLRLHLTSNHP
DNSLLFPKLLQKLADLRQLVTEHAELVQEINKTEDASLHPLLQEIYRDMY
Download sequence
Identical sequences Q5RGZ2
ENSDARP00000107246 NP_001154805.1.45394 XP_005164810.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]