SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107411 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107411
Domain Number 1 Region: 142-353
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-67
Family Arfaptin, Rac-binding fragment 0.00097
Further Details:      
 
Domain Number 2 Region: 16-99
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-18
Family PDZ domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107411   Gene: ENSDARG00000071152   Transcript: ENSDART00000127950
Sequence length 406
Comment pep:known chromosome:Zv9:3:4143996:4172544:1 gene:ENSDARG00000071152 transcript:ENSDART00000127950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTDMDYELEEDKLGIPTVPGTVTLKKDSQNLIGISIGGGAQFCPCLYIVQVFDNTAAAL
DGTLAAGDEITGVNGKPVKGKTKVEVAKMIQAVQGEVVIQYNKLQADPKQGKSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELEKTAELYKGLMEHTKRLLRAFYEL
SQTHRAFGDVFSVIGVREPQAAASEAFVKFAEAHRNMEKFGIQLLKTIKPMLHDLNTYLH
KAIPDTKLTIRKYLDVKFEYLSYCLKVKEMDDEEYSCIALGDPLYRVSTGNYEYRLVLRC
RQEARARFAKMRKDVLEKIELLDQKHVQDIVFQLQRFVSGMSHYYDDCYAVLKDADVFPI
EVDLSRTMINYSGQSLTYEDEDEEESSRAQSQQQEENGAEKLIDDQ
Download sequence
Identical sequences F1Q8Q4
7955.ENSDARP00000095747 ENSDARP00000095747 ENSDARP00000107411 ENSDARP00000095747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]