SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107556 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107556
Domain Number 1 Region: 1642-1771
Classification Level Classification E-value
Superfamily BRCT domain 1.14e-34
Family 53BP1 0.0000207
Further Details:      
 
Domain Number 2 Region: 1470-1538
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.82e-30
Family Tudor domain 0.0000703
Further Details:      
 
Domain Number 3 Region: 1786-1884
Classification Level Classification E-value
Superfamily BRCT domain 2.09e-25
Family 53BP1 0.001
Further Details:      
 
Domain Number 4 Region: 1417-1469
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-17
Family Tudor domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107556   Gene: ENSDARG00000079000   Transcript: ENSDART00000128192
Sequence length 1888
Comment pep:known_by_projection chromosome:Zv9:7:54345864:54392075:1 gene:ENSDARG00000079000 transcript:ENSDART00000128192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGESDLDSSFPQTENPCLIVEDSQPDSVALEDDPDTSYCALLARRLSNLQPTSQSPVL
ELISSPTKSCCLQTGSQIDKGGNTAHSGGFITLWIGDLTFICLHALQMVFDLLQTICRTI
LGQQLLSIVKCLKFALFLFLKGRTVTEHMESEANSTTHCTEAHGKIQCHLGFGLLELSES
QGVFEEDDLDGDVQKPTSQYVLKSSERVLSNKDGNSTGKHKQVYDMNIQASLVHAHNAGV
LSVCMETINLKSEVTSSCPLKPQDGESRKLSIQAILHSQLPDSQEDEEDVLVSSQDDMFE
KETNGTKADSSVSEHLPTSTPAQSLRLLHLSGQGTYVQESLSQQSVDFVAATQDNLSQTP
YIVPNSPTEKDQNCNETAESPMDTSAPPEDQPQGREEEPMDTDPCPKPQPTASTPVSQNS
PGFILEKRLSVPSQPEFSHDVFISTPSLEPVNNNQGTEASKRQLPHPNCTSATESTPPKP
SSPEEQLNKSSSSFSQPCEAAEDFQLELSSENSCFALKTQSFIVEEDSQATQIQDQGTVV
TDKSNSSPKPHSQNEDKNSTDSEPSKASNSNVPDSKITSAVPEKAEDLNISQKLNNGGNQ
IANATPGATLSQLSVSSECVSATPNLPQTSKSTDAGCPQASPLTDKPATPVPVAQHTQSQ
SVLTASSQKNTGNKEKHDGQNQRLSQPMLHSHSVTTDSVRNVEEEEQMEEGEIKSTVKGD
DTGINLALSQSQALSPEPMEEEEEKGEASIRSSSREESFSVMVLEESQRVSQEKVQKGKS
PPFKSSLQPVSGSIQDKPEALAKISGSQPVSSTKVSPLRLEKTKSQNTQPSSSGQQKVNS
DNAANKSLSDSSGELPFHFTLPKEGELIRPAVSATPPQISLLKKTPRHSTPIEMNSFSEP
SVGDVTRETMANSEISVEESREGEEPVAAEQDGKLSLRMKLVTPVEEGSSGPECFSLQTV
ITNNINFSATAVAMAVTSPSVFSRVREVHRQTQVEDDAESSDPLIRPVHPALSIYMNSSS
KLKKTSDQIDFFHKKMLKPRTPDLVRKCQFLQLSEQQITKIYKGHHGSAGISTVLEEHTL
FSLANKNLPSVTRKFHNYIALKTLQPSQLLSPTITNDSELSPNCPKETSNSSRASVTEAV
SLNPGALEADSEALVSGLLSPAREREALDTFDRPQTPVRKHVRTIQEVRTTVTRIITDVY
YEDGREVNRKVTQESEEPVVDRCVVENDISPSRTGSSMTSGDLADVSSLSSKAPSHHSSS
GTSSGGLGPIRMPDFLMPPSRGAKFGRRGGRQQQPRTLTLVVGSEVTDARGSRVSTQLSP
RGRARRGRPPSRVYTSTISKAIPNWVSTHPISNNIFQGGRPGQRGGAHAPGGASSSEEEP
FAQRHVQMPISPVEPSATSHSESLNTTSPDNSTGSSSFVGLRVLAKWSSNSYFYSGSITR
DLGENRFRLLFDDNQECEVQGKDILLCDPIPLETEVTALTEEEYFNIGVVKGHKTQGSEF
LYCVEKDGQSSYYSRTSVILSMEQGSRLREQYGLGPYEPSTPQTMACDISLDNLVEGKRR
RRGNCSGAGTPTRSSSNSPRNPGPSGKRKLISCTEEERTPPKRGRRGAGARVGTVPTGRR
IAACNTSGSGVDLPPDPNDLVATHGPLPENSSLFMGFVFLLTASSEGDRYSSHQSSDEDE
EYVQRAPYNKHYTVSQLEAGGGMILLDFNEEQHGQCKAAYQSLLIADQHCRTRKYLLCVA
GGVPCVSQMWVRDCCQEKKLLNYRNYLLPAGLGPGGRIVEWHPRSNPFKALKVMLIAEDR
VDLWTSLLSMGGAEKVYRQESQNISDDLDHVKFDVAVTSSACTSEEVKRVASDMPVVSLE
WLIQSLICGKCLNFDSNSEFCHNTYVFH
Download sequence
Identical sequences ENSDARP00000107556 ENSDARP00000107556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]