SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108325 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108325
Domain Number 1 Region: 6-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-73
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 389-569
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000025
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108325   Gene: ENSDARG00000035420   Transcript: ENSDART00000123562
Sequence length 800
Comment pep:known chromosome:Zv9:5:37301595:37361639:-1 gene:ENSDARG00000035420 transcript:ENSDART00000123562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHPALEFSDCYSDSPDFRERLKCYENELEKTNKFLKDVIKDGNNVINTFKEYSLAVQKF
SQTLQSFQFDFIGDTLTDDEMNIAESFREFAGLLQDVEEARMMLVQNASDLLIKPLEKFR
KEQIGVTKERRKKFEKESEKYYSQLDKHVNLSSKKKETQLQEADEQLDKERQAFYESSVE
YVYQIQQVQEKKKFDVVEPVLAFLQSILTLNNLTVEMTQDFLPYKQELQLSLQNTRNHFE
STREEMEELMKRMKGSAKISIRHGQPATMEGYLYVQEKWALGVTWVKNYCKYFKDNKLFI
MVPMEQKAGIKQTTAQLTLKSCIRRKTDSTDKRFCFDIETSERGSPVLLQAISEVNRKQW
IEAMDGKEPIYHSPIQKQAEMELNDLGFKFVRKCINFVETKGLTQEGVYRTVGSNIQVQK
LLNAFFDSKCPADVDFNSSDMDIKTITSALKFYLRSLSEPLMTYSLHGELILAAKSENLD
YRLGAVHSLVYKLPERNREMLELLIKHLVSVCSHSSENLMTVSNMGVIFGPTLMRAEEET
VAAMLDIKFQNIVMEILIEDYSKIFKGPPEESVPPPVPPPRVSPRRRQPITISKRPARVY
TGLQPPAFERRELNGATHNNGEPEGDGGPVPQQRTKLIPPSISPPSIPLSSPTSRRPLHP
RPAVRLLEPEVSRFDARIQDGLRSDATTNGDSGGTVNRAQSFQKRTQLKGTTGKQAAAAA
GNSREAQGLKRRSFSEKSSICRPPTRPPDPPSRLFSKPPNEDTPPSYVASKTKFFENASR
QMGSSSPNASPAASRDENTK
Download sequence
Identical sequences F8WJN2
ENSDARP00000108325 ENSDARP00000108325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]