SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109370 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109370
Domain Number 1 Region: 305-551
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.26e-60
Family Nuclear receptor ligand-binding domain 0.0000000133
Further Details:      
 
Domain Number 2 Region: 184-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.11e-25
Family Nuclear receptor 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109370   Gene: ENSDARG00000035966   Transcript: ENSDART00000128345
Sequence length 553
Comment pep:novel chromosome:Zv9:18:40220076:40238456:1 gene:ENSDARG00000035966 transcript:ENSDART00000128345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLPLGTKPYTEHIDDFLKAETGQWNAKTDCPESSYIKDDKELNLIMEPPNPDFDITVLES
CYDSTERKQQCEFIEESSALISSQAIQQVVVDSSSNFQLDMNQTTLVLPPPRTVSASLDR
GLLNFDVPSATHMMSKADISKWMSAADSPFWYQSANEEHAGYTPDCLIPRSQTAYTAFSG
VPSQRQCVICGDEASGCHYGVLTCGSCKVFFKRAVEGHHNYLCAGRNDCIVDKIRRKNCP
ACRLRKCYQAGMMLGGRKMKRFAGLKVMGLSPSLMFQSPLSLLTDGQTLSSLPCMSAMRE
LQLSPQMISILENIEPQVVYSGYDNTQPEVPHLLLNSLNRLCERQLLWIVRWSKSLPGFR
NLHINDQMTLIQYSWMGLMLFSLGWRTFQNVTPDYLYFAPDLVLSNDQLRRSPIYDLCLA
MQFVPQEFANLQVTKEEFLCMKALMLLNTVPLEGLKSQTQFDEMRQNYICELSKAIQLKE
KGVVASSQRFYHLTKLMDNMHEIVKKVNLYCLSTFIQADAMKVEFPEMMTEVIASQLPKV
LAGMVKPLMFHHK
Download sequence
Identical sequences B0V3V6
ENSDARP00000109370 7955.ENSDARP00000052205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]