SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109637 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109637
Domain Number 1 Region: 78-89,169-400
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-42
Family Nuclear receptor ligand-binding domain 0.00051
Further Details:      
 
Domain Number 2 Region: 6-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-28
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109637   Gene: ENSDARG00000014480   Transcript: ENSDART00000122773
Sequence length 422
Comment pep:known chromosome:Zv9:21:7739454:7759555:1 gene:ENSDARG00000014480 transcript:ENSDART00000122773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDGGERWCLICGDRASGLHYGIISCEGCKGFFKRSICNKRIYRCNRDKNCQMSRKQRNRC
QYCRLQKCLQMGMNRKAIREDGMPGGRNKMIGPVHISLEEIERIMSGQEFKEGSDLSDSW
SHGYSNHSSPGNSLSEGGQSLSFSSSRSVSCRDECISPQLTHTFLMCKYPLPPPTGSILK
TQTHTLTGQILADEDLTPLTTPMLIEDGYSVTQSELLALLCGIADELLFRQIVWLKRLPF
FTDLSIKDCTRLLGSSWHQLILLSSITVHSAQILGELANVTHHYTPSSHTLQRFGEDAME
VMESLNFLFRKFHQLNISNEEYSCLKTITLLNQETTGLCNTSMLKQLSERYWTLCRELTE
RLHPQRPKRFSDIITCLTEIRHTSGKMMSIPLEQLPLLFKAVLYSCTTNQNPWLPKSSTS
RT
Download sequence
Identical sequences F1QEH1
ENSDARP00000109637 ENSDARP00000109637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]