SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109982 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109982
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000986
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 
Domain Number 2 Region: 196-299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000176
Family V set domains (antibody variable domain-like) 0.079
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109982
Domain Number - Region: 116-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0551
Family C1 set domains (antibody constant domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109982   Gene: ENSDARG00000088680   Transcript: ENSDART00000126270
Sequence length 334
Comment pep:known_by_projection chromosome:Zv9:24:25855931:25862131:-1 gene:ENSDARG00000088680 transcript:ENSDART00000126270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLTHVHVTCTFSEDCVLPCVFEAVGDETIYWFKQNVLIHTYNLESGLSDQHKSKTSLFT
DTISSGNASLHVPKSGPQDRGKYRCVVSSREPSEHIIIVTVEAPITSVSLETTGLSGFEE
VKCSSRNIYPAPRITLFTEPTAQPDALHPYTRKTADPRGLYTVESKLLKLEDLTYICLIQ
SFYRSQTWRTSLQEKAHFIIKEGQDFILPCVAPWSLQNFTVTWSFTREYKSTSFFTYDSL
TQLSSSVWQKKVRLVTPGGEGGDGSLWLQSPQRLEHTGTYTCIISAPQTKHQVQIRLNII
PMTVRTLITNMLSCQFVTILCLANYWLFIMNYVK
Download sequence
Identical sequences ENSDARP00000109982 ENSDARP00000109982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]