SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110333 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110333
Domain Number 1 Region: 12-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-78
Family BAR domain 0.0000000491
Further Details:      
 
Domain Number 2 Region: 281-361
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-23
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110333   Gene: ENSDARG00000067958   Transcript: ENSDART00000129967
Sequence length 365
Comment pep:known chromosome:Zv9:2:50027864:50081696:1 gene:ENSDARG00000067958 transcript:ENSDART00000129967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQLMSEKVGGAEGTKLDEDFKDLERKADITSKAISDVLCKTTEYLQP
NPASRARLTMANTMSKMRGQVKSLGYPQAEGLLGECMLKYGRDMGEDTNFGGALVEMGEA
MKRLAEVKDSLDIDVKQNFIDPFQTIVDKDLKDIQHHLKKLEGRRLDYDYKKKRQGKIAD
EELRMAMEKFEESRDAAETSMQNLLDTDVEQVSQLCALVESQLQFHKQSMQVLEELAGAM
RERVNKAQSQPRQKRMPVSRPSIDYSDPEDSNGGWNPSAAAPPSYSSTAPSFNRASSRQK
RNSADQPCCRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYVEV
MVPLR
Download sequence
Identical sequences Q1MT71
ENSDARP00000110333 7955.ENSDARP00000088739 NP_001099076.1.45394 ENSDARP00000110333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]