SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110559 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110559
Domain Number 1 Region: 668-813
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-44
Family Toll/Interleukin receptor TIR domain 0.000000575
Further Details:      
 
Domain Number 2 Region: 41-208,387-575
Classification Level Classification E-value
Superfamily L domain-like 6.32e-42
Family Ngr ectodomain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110559   Gene: ENSDARG00000037758   Transcript: ENSDART00000122568
Sequence length 818
Comment pep:known chromosome:Zv9:1:8060152:8064588:1 gene:ENSDARG00000037758 transcript:ENSDART00000122568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFACLFSFIMSTAKLQFTHRRGVDTIMAVRMRLVGTMTAIILIMFILAQGLECSQTCKCD
QMYFCNCSSNNLHQVPTVPSDVLGLDLSFNQIESINMTDLSSYNELIILNLHKNKLRHIH
RDAFKSQHNLEVLDLSLNNLNNLSPSWFHKLKSLQQLNLVGNPYSTVGPAPIFKSLVNLR
TLHLGSPSLRELHKNGLDVLTHLDEMTFFGSNLRSYENGSLKAARPIGSVSLSLQNLFES
DPELVSKVLQDVSHPETLLIIKDVTMKTNTSTEPFKMVKEGGTKSLTFQNSSTTDQALTS
FLEFMDGSPLSFIGLEDIQFVGIGEWQKAKYTHHDSLRTAYLRNIEIEGFFGFSSMIELG
FLLKHFHNVSVINATVFVIPKETTFLLKNLEYMDLSQNLLTDLTIQPTLYTGSGAYQNLN
MLNVSQNVLKSLGLMSRLVTNLKKLKYLDLSYNSFVSMPEKCSWPVTLRFLNLSSTKLST
LTPCLPSSLTVLDLSENDLKAFKQRFPHLTTLILTGNRLMKLPDGKLFPSLNTLLIQRNA
LRMFNQSSLRSFKTLLYLEAGANNFVCSCKFVSFFKKDVEDLITLQDGRQNYVCNTPFTL
RGNAIDSVRLSVFECYMIPAVSVLCFGIITALGLVVLTCHKLHVIWYLQMTKAWIQAKRK
PAVGRLPEELRYDAFVSYSQHDAEWVEEILVAELEDTQPSFSLCLHKRDFRPGRWIVDNI
IDSIEKSYRTLFVLSEHFVSSEWCRYELDFSHFRIMDEHNDSAVLVLLEPIKKETIPKRF
CKLRKIMNSRTYLEWPEDEDKRDEFWSNLRAALQRDEC
Download sequence
Identical sequences F1QWS9
XP_005170910.1.45394 ENSDARP00000110559 ENSDARP00000110559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]