SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110761 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110761
Domain Number 1 Region: 277-515
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-66
Family Nuclear receptor ligand-binding domain 0.0000000227
Further Details:      
 
Domain Number 2 Region: 154-236
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-28
Family Nuclear receptor 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110761   Gene: ENSDARG00000016454   Transcript: ENSDART00000129589
Sequence length 551
Comment pep:known chromosome:Zv9:20:21667404:21707815:1 gene:ENSDARG00000016454 transcript:ENSDART00000129589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEYPEGDSPLLQLQEVDSGRVGGHILSPIFNSSSPSLPVENHPICIPSPYTDLTTSALC
PFTVPLCWGTTSPLSDCSSVRQSLSPTLFWPPHSHVSSLTLQQQSRLQQNHATSGTWTEH
TPHDHVEEENSKPLVKRVADTEETSVSLRGKADMHYCAVCSDYASGYHYGVWSCEGCKAF
FKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKCGLRRDRSSYQQRGAQ
QKRLVRFSGRMRMTGPRSQEIKSIPRPLSGNEVVRISLSPEELISRIMEAEPPEIYLMKD
MKKPFTEANVMMSLTNLADKELVHMISWAKKIPGFVELSLFDQVHLLECCWLEVLMLGLM
WRSVNHPGKLIFSPDLCLSRDESSCVQGLVEIFDMLLAATSRFRELKLQREEYVCLKAMI
LLNSNMCLGSSEGGEDLQSRSKLLCLLDSVTDALVWAISKTGLSFQQRSTRLAHLLMLLS
HIRHVSNKGMDHLHCMKMKKMVPLYDLLLEMLDAHIMHSSRLSHSGPRAPAAHKDNKSVQ
EAFPCSSQHGP
Download sequence
Identical sequences E7F7N2
ENSDARP00000110761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]