SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110930 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110930
Domain Number 1 Region: 279-517
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-66
Family Nuclear receptor ligand-binding domain 0.0000000227
Further Details:      
 
Domain Number 2 Region: 156-238
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-28
Family Nuclear receptor 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110930   Gene: ENSDARG00000016454   Transcript: ENSDART00000131069
Sequence length 553
Comment pep:known chromosome:Zv9:20:21655799:21707819:1 gene:ENSDARG00000016454 transcript:ENSDART00000131069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEYPEGDSPLLQLQEVDSGRVGGHILSPIFNSSSPSLPVENHPICIPSPYTDLGHDFST
LPFYSPALLGYSTSPLSDCSSVRQSLSPTLFWPPHSHVSSLTLQQQSRLQQNHATSGTWT
EHTPHDHVEEENSKPLVKRVADTEETSVSLRGKADMHYCAVCSDYASGYHYGVWSCEGCK
AFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKCGLRRDRSSYQQRG
AQQKRLVRFSGRMRMTGPRSQEIKSIPRPLSGNEVVRISLSPEELISRIMEAEPPEIYLM
KDMKKPFTEANVMMSLTNLADKELVHMISWAKKIPGFVELSLFDQVHLLECCWLEVLMLG
LMWRSVNHPGKLIFSPDLCLSRDESSCVQGLVEIFDMLLAATSRFRELKLQREEYVCLKA
MILLNSNMCLGSSEGGEDLQSRSKLLCLLDSVTDALVWAISKTGLSFQQRSTRLAHLLML
LSHIRHVSNKGMDHLHCMKMKKMVPLYDLLLEMLDAHIMHSSRLSHSGPRAPAAHKDNKS
VQEAFPCSSQHGP
Download sequence
Identical sequences Q7ZU32
NP_851297.1.45394 7955.ENSDARP00000017514 ENSDARP00000017514 ENSDARP00000017514 ENSDARP00000110930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]