SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111457 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111457
Domain Number 1 Region: 296-493
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-51
Family Ypt/Rab-GAP domain of gyp1p 0.0016
Further Details:      
 
Domain Number 2 Region: 470-591
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.28e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111457   Gene: ENSDARG00000057218   Transcript: ENSDART00000129146
Sequence length 664
Comment pep:known chromosome:Zv9:18:16661332:16679399:-1 gene:ENSDARG00000057218 transcript:ENSDART00000129146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAATTPPKVVFEHEGVFIHSSPDESEDQDLISGFLRIVEKEGETLVEYKPLEDADPSNML
CACKDSSSVVEWTQSSEENPHRPVDHQLSYETEWDMINAVSFRRKVHANGDGGSNHVNEQ
NKRAFSFNVCDLRSVTVKCEGWSYLTFRLKDGTALPAIHFHQGGSKAFLDSLRKSVQINE
SPDDESVLIVSTYSKAFSQSFENLLDDTNYGFVQKFKKDPYTTTLGGFSKVTNYLFDAFR
APELECQQRPAEEVADVLGELIPGLEINQQEEPGFEVITRLDLGPRPEMQRTGPVTMEEW
AKYQDLEGRMTNLPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSSTHEERKLLQKRKTDE
YFRMKLQWKSVSEEQERRNSRLRDYRSLIEKDVNRTDRNNKFYEGLDNPGLILLHDILMT
YCMYDFDLGYVQGMSDLLSPILFVMENEVDAFWCFVSFMDEMHENFEEQMQGMKTQLIQL
STLLRLLDLAFWNYLEAQDSGYLYFCFRWLLIRFKRELHFQDVLRLWEVMWTRLPCQNFH
LLVCCAILDSEKQKIMDRKYGFNEILKHINELSMKLDIEEILSKSESICMQIKSCKDLPH
SVSEILGLNTVSEPSAALETSEYGILESPQTSPRSSHRQDHVVSNGHSHLKETTQNGCKV
AFIS
Download sequence
Identical sequences F1QGW7
ENSDARP00000111457 ENSDARP00000111457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]