SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111735 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111735
Domain Number 1 Region: 42-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 121-165
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000484
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111735   Gene: ENSDARG00000016363   Transcript: ENSDART00000123395
Sequence length 253
Comment pep:known chromosome:Zv9:7:27555809:27562348:-1 gene:ENSDARG00000016363 transcript:ENSDART00000123395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYFLLPPRPRHHNPNVHTRGKLSELVSYWWRIMTASNMGNGPEKNFNAKEERKLRKPLIE
KKRRERINSSLEQLKGIMVDAYNLDQSKLEKADVLEITVQHMENLQRGHGQGGSNSPGTG
FESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSLPHISTEPSGTSSAGTS
SPLPLSPTQSPINLPSSLQPHALLLSPSPPSSPTHSLVRPREQSSPPSSPSPQSPASLPP
FFPGVDPSMWRPW
Download sequence
Identical sequences ENSDARP00000111735 ENSDARP00000111735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]