SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113204 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113204
Domain Number 1 Region: 8-133
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.78e-44
Family MBT repeat 0.0000257
Further Details:      
 
Domain Number 2 Region: 121-196
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.78e-31
Family MBT repeat 0.0000343
Further Details:      
 
Domain Number 3 Region: 232-253
Classification Level Classification E-value
Superfamily CCHHC domain 0.000017
Family CCHHC domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113204   Gene: ENSDARG00000094780   Transcript: ENSDART00000139565
Sequence length 253
Comment pep:known_by_projection chromosome:Zv9:24:43614248:43620225:-1 gene:ENSDARG00000094780 transcript:ENSDART00000139565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRRHLCCFHPQASSESMFAVGMKLEAVDRKNPCLVCVASIADIVDSRFLVHFDNWDDTY
DYWCDASSPHIHPVGWCQDHGRPLTAPQGHPNPEHFIWEDYMRDSGASAAPAESFSEISA
HGFQTLQKLEAVDRRNPMLIRVATITDTEDHRVKVHFDGWHEKFDFWVDSDLPDLHPVGW
CSRTGHPLEPPPLCHTIRSHDKLPAGPERCEVLLCLAYTSLSDVKSSMNQGVCPTPGCRG
IGHIKGAKYTGHH
Download sequence
Identical sequences ENSDARP00000113204 ENSDARP00000113204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]