SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113311 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113311
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 147-191
Classification Level Classification E-value
Superfamily LCCL domain 0.00000405
Family LCCL domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113311   Gene: ENSDARG00000015907   Transcript: ENSDART00000139912
Sequence length 289
Comment pep:known chromosome:Zv9:20:42385000:42410596:-1 gene:ENSDARG00000015907 transcript:ENSDART00000139912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGHTVLYGLILLYSIHPLVLAEKPDDGCGHYVLGQESGVLSSKNYPGTYPNNSWCEWRI
RVPIGHTIILKFGDLDMKKRDCESDYLKVLKGSYGSENVYWEYCGDPMPKPSQLHTDSNE
LTIRFRSSQHITGRGFLLSYSTENHKELLTCLDRGSHFTTAKYRKYCPAGCAALAGEVSG
DISLGYRHVSSGSLFSSGVSDKQRLILQENVSQACRVIYSFNMHPSRCSAGSFPNRFHMQ
SVSQQKKTASFVLLYGHLCAFLFLVLLVILAVNANIILLNSELLALLNY
Download sequence
Identical sequences A2BDL4
ENSDARP00000113311 7955.ENSDARP00000091712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]