SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113651 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113651
Domain Number 1 Region: 83-94,191-369
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-35
Family Nuclear receptor ligand-binding domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 11-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.97e-30
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113651   Gene: ENSDARG00000017704   Transcript: ENSDART00000141812
Sequence length 369
Comment pep:known chromosome:Zv9:8:54820581:54853620:1 gene:ENSDARG00000017704 transcript:ENSDART00000141812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRADEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCTQNQDCGIDKT
QRKRCPFCRFQKCLSVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKRALIRASGFKL
EANGTLLSGQTEFSSVGLQSPYDCPPPALGVALQNYGSFPAQYQYTAPSLPKSIKAEYPD
AYSSSPDSTLGYSYADGCLSASPHSVPINPALPPLVLELQSCDPDEEQVRGKICAYLHQE
QSGRGKLEKSRPFSLLCVMADQTLFSIVEWARSCVFFKELKVGDQMRLLHNCWSELLLLD
HICRQVHHGRDGSLLLITGQEVELSAVLDAGPPLSSMVERGQDLSRRLQLLQVDSREMAC
LKFLILFNP
Download sequence
Identical sequences A0A0R4ITX5
ENSDARP00000113651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]