SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113755 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113755
Domain Number 1 Region: 1236-1501
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 1856-2102
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-48
Family YWTD domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 508-766
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-44
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 4 Region: 1551-1808
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-42
Family YWTD domain 0.0000301
Further Details:      
 
Domain Number 5 Region: 183-440
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-34
Family YWTD domain 0.0000452
Further Details:      
 
Domain Number 6 Region: 2164-2434
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-32
Family YWTD domain 0.0000851
Further Details:      
 
Domain Number 7 Region: 1150-1230,1499-1545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 855-898
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 819-857
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 10 Region: 981-1015
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 11 Region: 943-980
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 2706-2741
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 898-937
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000159
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 14 Region: 1028-1064
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 15 Region: 2835-2876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 16 Region: 2664-2702
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 17 Region: 2-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 18 Region: 2748-2781
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 1810-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000344
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 2784-2824
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 118-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000718
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 22 Region: 2486-2523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 23 Region: 1110-1145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 24 Region: 2521-2564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 25 Region: 1074-1108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 26 Region: 45-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 27 Region: 2120-2167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000806
Family EGF-type module 0.012
Further Details:      
 
Domain Number 28 Region: 773-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000765
Family EGF-type module 0.072
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000113755
Domain Number - Region: 449-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 92-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113755   Gene: ENSDARG00000004789   Transcript: ENSDART00000133385
Sequence length 2895
Comment pep:novel chromosome:Zv9:22:14625395:14884368:-1 gene:ENSDARG00000004789 transcript:ENSDART00000133385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCDMEEFLCADGLNCVSESWLCDGEIDCPDASDEAPAICLRQVKVRCPVNNIQCLGTRRC
VHFSKLCDGVRDCEDGYDEGVHCRELVRSCQERRCQFDCVVMRNGTSCFCGEGFEVDEDG
RRCRDHDECRDYGTCSQICMNTQGSYRCACTDGFSLQANRRSCKAKTDPGDKPPVLLTTN
LNFISVLYLNGSTMPNLKSMETNGTQMLDFIYREESLCWLSVVQDTGQLWCARMTKLKGF
SEKHQIRIGQNLQNVEHMAIDWLTGNFYFVDRVNDRIFVCSEQGDTCVTIIDLDIQNPKG
LALDPIMGKLFFTDYGTVAKVERCNMDGTNRTKIVEYKTEQPTAVTLDLVKKLVYWSDAY
LDFIEVVDYNGKNRQTIVQGNSVSHLFGLALFEDYLFATCSEPSRESKVDIFRINRFNSS
DTNTIATLESARNVRVYHRLAQPTVRTHACSPDPHGRKGGCSHICLLSHNYKSRVCRCRT
GHVLASDGKSCKKPKNELFLFYGKGRPGVIRGLDMNIKSGDEHLIQIEGLVSPRALDFHA
ESGYVYFADTTSFLIGRQKIDGTARETILKEELDNVEGISVDWIGNNLYWTNDGYRKTIN
VAGLDRPSHTRRTLLEGNMSHPRAIVVDPLNGWMYWTDWEEDELIDSRGRIEKAWMDGSH
RQIFVTSNMLWPNGLTLDHSSSVMYWCDAYYDHIEKIYLNGSHRTVVYSGKELNHPFGIA
HYQNYIFWTDYMNASIFRLDLLSDDVSLLRAERPPLFGIQVYDPQSQKGNNQCSVNHGGC
SPSALCLTTPAGRVCACADGQHQEKDNITCSSPSEVTKIKRCSPAEFQCQNQRCIQISWK
CDGDDDCSDGSDEDPLLCSNRICPADQFKCLNNRCIPKRWLCDGTDDCGSNEDESNRTCS
AQTCQPGQFPCANGRCIPENWRCDRDDDCGDQSDESSSCDFPTCEPLTQFGCTNGKCISV
KWHCDSEDDCGDGSDEVGCVHACSVAQFQCSSGKCIPEHWMCDGDNDCGDLSDENATCSR
TAISAINDCSEKEFHCRGDGTCIPEIWRCDGDKDCEDGSDEFACEGAKRMCDPKAKFTCK
VSGKCVSKDWVCDGDIDCEDQSDEEGCEVSVCKPPKFPCANDTSVCLPPERICNGWKDCA
DHSDEGPYCDECSIRKGGCSHECSVAPGKGVVCSCPAGFQLGSDAQTCEILDYCSKHLRC
SQVCEQHKNTVKCSCYPGWSLGSDGDSCYSTDPFEAFIIFSIRHEIRRINLHKGDYSLLV
PGLRNTIALDFHFSQSLLYWTDVVEDKIYRGKLSEGGGVSAIEVVVQHGLATPEGLAVDW
IAGNLYWIDSNLDQIEVSKLNGELRTTLIAGGMEHPRAIAVDPGQGALFWTDWDATFPRI
EGASMSGKQRHVVFKDMDTGAWPNGLTLDHMESRIIWTDARSDAIYSALYDGTGVIEILR
GHEFLSHPFAVSLFGGNVYWTDWRTNTLTKANKWTGANVTVIQKTSAQPFDLEIYHPSRQ
PQTVSPCAGNGGRGHCSHLCLLNYNGSASCSCPHLMKLSANNSTCQGVKRFLLYARRSEI
RGVDIDNPYLNVIMALTVPDIDDVTSMDYDAVEERIYWADVKSRTIKRAFINGTQLQTVL
SGDLSNVRGLAIDWLSRNMYWMSSDNDETHINVARLDGSLKTTVVHGMDKPKSLVLHPSK
GKMFWMDGGTINMANMDGSNIKILHQNQKEPVGLSIDFSSNKLYWISSGNGTINRCNLDG
SGLDVIDSMKSQLRKATALAVMGGKLWWADDVLAQLGTVNKRDGKNLTVLRNKTTGLVHI
KVYDKDTQKGRNPCVLNNGGCSQICLPTSEITRTCSCTTGYNLRQDRSTCEGLQSFLMYS
VNEGIRGLSLDPSDNSEVLTPLSGTLFAVGLDYHAKNDTLYWTDMGSNKISRSSRDQTWR
EDIITSGLGRVEGLAVDWIAGNIYWADHGLNLIEVARLNGMYRAVVISEELDQPRAIAVH
PVKGFLFWTEWGQSPTISRSRLDGSEQSVLVSTGLARPNGVSIDYQENKLYWCDARNNKI
ERINLERGEQREIVFSSSGVDMFSIAVFGAYLFWSDRAYANGSIRRASKKDAVDVVTIRS
GLSVSLKDVKVFNQDREKGTNACSKSNGGCQQLCFYLGNNRKTCACAHGYLAQDGLRCIR
YEGYLLYSERTVLRTIHLSDENDLNSPIRAYENPVYFKNIIALAFDHRQNAHGTNRIFFS
DVHYGNIQVINDDWTGRRIIAENVGSVEGLAYHRGWDVLYWTSSTTASITRHHIDQSRTN
AFDRDTVVSLSEEDHPHVLTLDECQNLMFWTNWNEQHPSIMRSTLTGRNIRIIVSTDVIT
PNGLTIDHKAEKLYFSDGSLGHIERCDFDGSQRYVIVKSGPGTFFGLAIYRDFIFWSDWT
RRAVIRSDKFTGANTKVLRSDIPHQPMGIIAVSNDTNSCEASPCSVNNGGCHDLCLLTPL
GVVNCSCRGERILLDDNRCVSPNSSCNIHSEFQCGNGECIDYQLTCDGIAHCKDRSDEKM
QYCENRNCRHGFKSCYNQRCVSNQRFCNGVNDCGDNSDETRRVCLPSTAVPMAPVFPHHP
GVIRSSIALTHRTRRAVAAIPRRCVFIPPGSVMEPMTAGITQMKHTAMSIRVKTVILLVP
VETVSPASGCAMDRKTVRTELTNSSCLWNQFACSKNKCISKQWLCDGEDDCGDGLDESQE
ICGSASCSPGLFSCPGSYACVSRNWLCDGERDCPDGSDELALAGSPNNTCTDSTFQCRNQ
NCIPRRFVCDHDDDCGDASDESLECEYRLCKEEEFRCADGRCLLRAQWECDGFPDCQDQS
DELPLNPKCSAAGDLCNGTVFMCANGRCVPLGSVCNQHDDCGDRSDERNCHVNECLNRKV
SGCTQDCQDLPVGYK
Download sequence
Identical sequences F1QTG8
ENSDARP00000113755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]