SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113856 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113856
Domain Number 1 Region: 8-183
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.11e-40
Family Nuclear receptor ligand-binding domain 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113856   Gene: ENSDARG00000055854   Transcript: ENSDART00000142573
Sequence length 186
Comment pep:known chromosome:Zv9:16:29577824:29591484:1 gene:ENSDARG00000055854 transcript:ENSDART00000142573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKEVVRTDNLKGRRGRLPSKPKSPLQPEPSPPSPPLSLLNALVRAYSQSTPRELDYSQF
SAVEPVGLSESQQIQMFYRVLTGSMEVTRCWAERLPGFSELHHDDQNMLIDSAFLELFVL
RLANRSLLVDEKFVFCTGLVLHRLQCLRGFGEWLDSIRDFSAHLQELNLDMPAFSCLCAL
VLLTGK
Download sequence
Identical sequences E9QI47
ENSDARP00000113856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]