SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114497 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114497
Domain Number 1 Region: 79-93,200-449
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-62
Family Nuclear receptor ligand-binding domain 0.0000000693
Further Details:      
 
Domain Number 2 Region: 11-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-29
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114497   Gene: ENSDARG00000017704   Transcript: ENSDART00000143396
Sequence length 454
Comment pep:known chromosome:Zv9:8:54832336:54858194:1 gene:ENSDARG00000017704 transcript:ENSDART00000143396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRADEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCTQNQDCGIDKT
QRKRCPFCRFQKCLSVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKRALIRASGFKL
EANGTLLSGQTEFSSVGLQSPYDCPPPALGVALQNYGSFPAQYQYTAPSLPKSIKAEYPD
AYSSSPDSTLGYSYADGCLSASPHSVPINPALPPLVLELQSCDPDEEQVRGKICAYLHQE
QSGRGKLEKSRPFSLLCVMADQTLFSIVEWARSCVFFKELKVGDQMRLLHNCWSELLLLD
HICRQVHHGRDGSLLLITGQEVELSAVLDAGPPLSSMVERGQDLSRRLQLLQVDSREMAC
LKFLILFNPNVKLLENPQFVESVQEQVNGALLEYTLFSYPQCVERFSQLILRLPELRSLS
AEAEDFLCYKHLCGEVPCNNLLIEMLHAKRSSAQ
Download sequence
Identical sequences F1QJG0
ENSDARP00000009236 ENSDARP00000114497 ENSDARP00000009236 XP_021334008.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]