SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114595 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114595
Domain Number 1 Region: 835-1005
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.04e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 
Domain Number 2 Region: 980-1101
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 3 Region: 142-188,316-402
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-26
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 4 Region: 2-136
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-23
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114595   Gene: ENSDARG00000075156   Transcript: ENSDART00000143766
Sequence length 1230
Comment pep:known_by_projection chromosome:Zv9:9:31618908:31672670:1 gene:ENSDARG00000075156 transcript:ENSDART00000143766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKRFALWYMGWSALDRRTTLPMLPWLVAEIRRKSEKNESGPTQAREVQLHLSPPLIRCVP
ASSSNPSVFIFEHKAQFISRFIHNSHDLSYFAYLIRSQPENPESEMACHVFKACDPNQVP
EVISSIRQVSKAALKEESKPKQESDESFYNSQKFEVLYCGKVTVNHKKAPSTLIDDCIDK
FRQHEIERKRLRLLNGQRNSTEAPVEFIMGEDPLSSSLCEVDEPESEPSLTEEELSEVGN
GKLDLANSSSTGSLRGAFPECILEDSGFGEQQEIRTRCNSLAGGLQKRPREAGKGTTRRR
HASAPNNVQPSDADKNRTMLFQVGRFEVNLISPDTKSVVLEKNFKDISSCSQGVKQTDHF
GFICRDVVESGPAQYVCYVFQCASESLVDEVMLTLKQAFTTAAALQSSQNQIKLCEACPM
HDLHKLCERIEGLYPPRAKLAIQKYLSQLSDNEQVNIFEQVQKMKPASDHEENELVILHL
RQLCETKQKSHVHIGEVTQNVSGSSVTSDNSSAGRNKLDVFKNKARSSLTSSLENIFSRG
ASRMRMRLGSMGSFDRQGDSPGDSPPGTPPSYLEEDPDAPQFRRRAHTFSHPPIKKKISF
TDVSSQANKAPLRRQQSLAPELLQSSTVGFSRVRSVSESESYFGLSSSFHTPTFLKSFYQ
GSLGSLASLSDSGSLKSGNGEGRKRSLSGCSTDSLTLVPPPRRVSWRQKIFLRVASPMNK
PSDSMQNVDHMDGRELLPLSPRALTQDQGDQTGPQSPEQSSAGQKRSPADYRGLWKKAIH
QQILLIRMEKENQRLEASRDELHIRKMKLDYQEVCSCSKELQALWDRKLSSPCRTKVQWN
KEEIHSAVCQGVPKSRRGEVWLLLSQQHRLRQRLPHRQQPPETPFQDLLKQLTAQQHAIL
VDLGRTFPTHQYFSAQLGAGQLSLYNLLKAYSLLDTEVGYCQGISFVAGLLLLHMSEEQS
FDTLKFLMYDLGIRRQYRPDMISLQIQMYQLSRLLHDYHRNLYSHLDEHEICPSLYAAPW
FLTLFASQFPLGFVARIFDLLFVQGTEVIFKVALCLLSSHEGEILECDSFESIVDYLKST
IPTLTHSQMEEIITKAIEMDISKQLQAYEVEYHVLQDELSDAPPLSEDSDRLDKLEKANT
QLRKQNMDLLEKLQAARLKIQTLESSVESFLSRESKMKHLIRSLEQEKASYQKTIERMRN
SLPSDTTAEVEMTQLKSSTNGKAKAACNKP
Download sequence
Identical sequences F1QE75
ENSDARP00000114595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]