SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115396 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115396
Domain Number 1 Region: 2110-2250
Classification Level Classification E-value
Superfamily SET domain 8.5e-44
Family Histone lysine methyltransferases 0.0042
Further Details:      
 
Domain Number 2 Region: 55-166
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000533
Family Canonical RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115396   Gene: ENSDARG00000060030   Transcript: ENSDART00000131774
Sequence length 2253
Comment pep:novel chromosome:Zv9:3:32851133:32879554:1 gene:ENSDARG00000060030 transcript:ENSDART00000131774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDSGADTQRTLSLQWKSYKLVQDPALRRVTQKIYRYDGIHFSVPDSGFPPVGDLRDPR
PRRIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTNTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLI
VSGSYTPQTVPTGGKALTEKFQPPVPTQPDTSSDIRRRLSTDQMAAPAAATLNSGSTTPC
SVDTGFGDQRLDTPPSSMGGPYTPGSSTSSQGGGTPYTPRSGTPFSQDSGYSVARHGGYS
STQSFPQQDMLPSSSCSSSAVSSSSGFKPPRFHDDLHAPPPQDVFQRGRPGFPASAPFRP
NEPPYPYPSAGGSGMHMPLHPPVPPQFEQPPLSDRERERDRERGHRDRERDSGGGRYGGG
ISSRRSTYPYQQETNSSSTSKTYHAHHSHHADRREDRDGRGYRRDSSGSRSGDHSRHRNH
HHSHNHHSGGGGSSRRRSSRDREWERDRDGEFNPSDPRYGSHSNSSHHSSNSLSPPSATS
SFGGFSSSKDLSPYDTPSSSRLEPSSAFRPQQGAGERAFGMGGSMDNDYRGHSHHTPLAP
PPPPPPLPPASVIAAAVAETLSSLDFGQDSPIREEQWTKPKRHPSTPPLPPRTPPTSSPP
HASIPSSSTSPSSTSLPHHLPSSTASLSPPPPQRDSSPEPDSTNESLPFMHHSSSLDSRI
EMLLKEQKAKFSFLASDDEDDEKDEVRERGKSENNKDGGNKLREHGGERPSHKRQGEMEA
GQQRRRGEKDGRRSRGKRQVSGVGEGRKTPPEVASSTPTVHSLVSESLQGQIPPPQEEHT
TSDTHRAPHTPPTYNGEAQPSPRSSGEDMEISDEDDNTITTATSHPAASSSSSPAASSQT
VLPSQTTDPSASPAPDTSQHFSTTMPPPPIPSYPPHLPPPPLPGFSLQPPPPPGIPPPLP
HMELHPEYPPPLPHHMYDYASSMELMSQYCGGAPMSFQMQTHMLSRLHQMRMASSNSTAA
PPAEVPPASEYPPSYHLHSIPPPHAPPHHPHHPYMDQDGNVASHYDQDHRYIPPPLPYAY
PDPHAAQLPHHHTIPPPHTPWPPHLLPQQFPSHYPPPGFGAVPGVDGELYGAAGDQMAIM
GHNPCEAVVQQVLAALIEEMKNIMQRDLNRKMVENVAFGTFDEWWDRKERKAKPFQTAMR
GVAVVREEEKKEEKTTTTMTTSNRPREPLMSLVDWAKSGGMEGFSLRGALRLPSFKVKRK
EPQELVEGDELKRARPSTPPDEEDEDSYQGKSADAAAGRTEERRVAERGATRRRSRAKAR
KPYELDSEGEETSDGSSSEKEDEDSDKVDESEDEALSADSDDESVSSSSSESSSSSSASS
SSSDEEDEEEGEQAAESESLDTMDESTMDSVAAVDTEKDERDKASLDQPSVTTPEDKQEE
EKSATPVPPSSPYPRPSSPILLLPPLKKRRKTVSFSMEESEVKPSVQSSTASSPSPSPVS
QASDVPPSVSPVSTPTPAAPSASSKPVPMLLPFASRPSESSALTSPASPSAILTVPPPVR
SLRPDEPKKSPGPPPSPQTPPPKNSTKRGKDSPRTPPAPVCLTVQNLPLDHASMVKMAYE
DPVPLPTTQKGRARGRPRTLSQSASASHLHPALEEEDEDEEELEQQLKLREQLGVSSLLQ
LASAPKPDLSVLADVALKMDPEADIDSEETETSDEAEEHKLEEEEGDFFAPHPRQPLLDP
EGLFVMQEHNYSKTPAPQHNTPPQKRTKQDSTVLLPADLNQHGVQEAPEEVIGEALAARA
EAPELYGDLDLLCDGREAAETQTKTLSSPYKRTGSISKEVDLEERGKGKNKKRSRKDKEN
EELQTSKKQKEKQVKKQKKRKLEEFEEDVDVEQLESGELSSSTSDSGDSDFGLERSLEFE
KEEVRKSERLFLQEAGLTPSTQRRPKHTPESLPLPRPSYKNRSEFEQMTILYDIWNSGLD
QEDMRLLKSTYEKLLQDDHGTDWLNDTHWVPHTITNIPNPRRKKKTADGQLREHVTGCAR
SEGYYAISRKEKDVYLELDQPVTLREIGDYDTAGSNRVLSERRSEQRRLLSAIGTPAVMD
SDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMVADNREKRY
AQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPI
GVNEEITYDYKFPIEENKIPCLCGTESCRGTLN
Download sequence
Identical sequences E9QGQ0
ENSDARP00000115396 XP_021329647.1.45394 XP_021329648.1.45394 XP_021329977.1.45394 XP_021329978.1.45394 ENSDARP00000115396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]