SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115426 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115426
Domain Number 1 Region: 362-547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-68
Family SPRY domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 27-100
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-20
Family RING finger domain, C3HC4 0.0044
Further Details:      
 
Domain Number 3 Region: 149-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.02e-17
Family B-box zinc-binding domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115426   Gene: ENSDARG00000093049   Transcript: ENSDART00000135762
Sequence length 551
Comment pep:novel chromosome:Zv9:19:2810636:2824100:-1 gene:ENSDARG00000093049 transcript:ENSDART00000135762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESTNGKAAKRRSIDEPPLMSFSSGPLSEELQCSICLEVFTDPVSTPCGHNFCKSCLNK
CWNNSKTCSCPNCKETFTQRPDLKINTTLREISEHYKEKKPEEKAEVVCDVCEDRKLKAL
KSCLVCQISYCQTHLEPHLRVAGLKKHKLMDPVRNLEDYICQNHDRPLELFCRDDQTCVC
PMCDLTEHKNHKTVPIEEESKEKKTQLMKTQKDVQQMIQDRVKKIQDVKHSSGVRKINSE
KEKAAREELFTDLIRSIERCQTEQLKMVEEQQKAAEKQEEELIEELEQEITELKMRNTEL
EQLSHTEDHLHLLQSYSSLQRPTDTRNWNEISLKTHNSLEALRKALDQLKDTVEEKFSQT
ELKLMQQYAVDVTLDPDTANPYLILSDDGKQVRCGDIEQELPDKPQRFDKYEDVLGKEGF
SSGRFYYEVQVKKKTDWTLGVVRESVDRKGEITLSPGNGYWTVWLRNGNEYKFCADSPVS
LSLKVKPQRVGVFVDYEEGLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEDNDDGKNSA
PLIITPVNYNK
Download sequence
Identical sequences A0A0R4ISE2
XP_005173784.1.45394 ENSDARP00000115426 ENSDARP00000115426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]