SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000116090 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000116090
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.71e-55
Family N-terminal domain of cbl (N-cbl) 0.00000174
Further Details:      
 
Domain Number 2 Region: 251-337
Classification Level Classification E-value
Superfamily SH2 domain 7.24e-48
Family SH2 domain 0.00000351
Further Details:      
 
Domain Number 3 Region: 344-421
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-42
Family RING finger domain, C3HC4 0.0000111
Further Details:      
 
Domain Number 4 Region: 165-250
Classification Level Classification E-value
Superfamily EF-hand 7.71e-37
Family EF-hand modules in multidomain proteins 0.00000857
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000116090
Domain Number - Region: 886-924
Classification Level Classification E-value
Superfamily UBA-like 0.000316
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000116090   Gene: ENSDARG00000015199   Transcript: ENSDART00000137508
Sequence length 934
Comment pep:novel chromosome:Zv9:10:29269282:29412166:1 gene:ENSDARG00000015199 transcript:ENSDART00000137508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALSGRPPNNRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPRL
QLKNSPPYILDILPDTYQHLRLILCKYEENQRLTQLSENDYFKVYIDSLMKKSKRAIRLF
KEAKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAEFWRRS
FGEKTIVPWKMFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGS
ILRNWNFLAVTHPGYMAFLTYDEVKARLQKYINKPGSYIFRLSCTRLGQWAIGYVTSDGN
ILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCE
MGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDSDGQGCPFCRCEIKGTEPIIVDP
FDPRNEGAKCFHLDHFSSPLLDPDDDDDRDGLLVIDHIKKNSPIMSPNSSPVCERRKTAA
DHMGPHLNIPPVPPRLDLIRSPAPSPTASPKSSPGMSRKQDKPLPAPPPPQRDPPPPPPP
ERPPHLPQEGRAAWLVTPSSGLPRDPRAPLEAWSPKDSTALSDCRTSAADRSPKLAHAAP
AHINERPLSCSSADLGLNRNRLIAQTECSKSFVNGLLPGDEYDIPPLRHSPPILDNNQRH
MNPFTSPRSLTDRVEDDYQIPSSHPVCITQPAICIPFRIPNRALENGSTDHSTDIKKHKP
PEHGGFDSGPLISAVSHTTQCPLHNRTPSDYDILLPPQASPMEDPFNALPPSQPPPPPPI
RNSFTEASSSSLYPRPARPSSGHDHFLLSPDTFIDSLNNSAPSPPVRRQTGDNMKTPFRA
PQDYDQLPPTSVAGDCFRAPERPPKPLPRIIPPDIHRRPHESSRENVDAKIAKLMGEGYS
FEDVKRALMIAQNKVDVARNILREFALVAPRQGL
Download sequence
Identical sequences F1R6A7
ENSDARP00000116090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]