SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000116692 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000116692
Domain Number 1 Region: 91-163
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000536
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000116692   Gene: ENSDARG00000039152   Transcript: ENSDART00000143912
Sequence length 198
Comment pep:known chromosome:Zv9:2:16302921:16305991:1 gene:ENSDARG00000039152 transcript:ENSDART00000143912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLGETLFEISGQGPAPMKDYFHFAITKSEVIWSWWKISLRLGCKNAPPGQLRETHED
FLEDNRLQNQVAMVFGSHILQYSKNLCQGYYDFIARLPNALLFKIMGYLDLENISVLSRT
CRKFRELCNSEEFWEQTVRKHCDTVTPTVEALAKEVGWKTIFFTNKLQLQLQISRRKQKD
NQPCEDKDEPSSSSVALE
Download sequence
Identical sequences B0UXM1
ENSDARP00000116692 7955.ENSDARP00000057193 ENSDARP00000116692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]