SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117645 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117645
Domain Number 1 Region: 446-500
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000202
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Domain Number 2 Region: 270-366
Classification Level Classification E-value
Superfamily PX domain 0.000000154
Family PX domain 0.0098
Further Details:      
 
Domain Number 3 Region: 931-962
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117645   Gene: ENSDARG00000012738   Transcript: ENSDART00000144728
Sequence length 987
Comment pep:novel chromosome:Zv9:25:13323351:13379067:1 gene:ENSDARG00000012738 transcript:ENSDART00000144728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVENRCFVQREEVYRWFSVLSSAQRAEFLCGLLDLCVPIELRFLGSCLEDLARKDYHSLR
DAEIKANNPADLANLANITDEVVRSKLLVSLALLSSDNRVAAGVLFRTLTHIDTIINNYG
LKLNDGQTGEQFLLLFTMASNHPAFSFHQKQVLRQELTQIQEILQVTVGEAPSTSHGGGA
SAASVPTVSATPTFSSYITASTFNSCQAGCPCSKTGQREATGSQKDDSLSPEIMPPSPSL
LCQEMPLKVHVGKPSKVYVERIELRGVTSKSDKSAEYILEALWSDSTLSTVSKTPQEVTD
LISQLSPLFPDECLEKLLPQMPGLDSTHELDPRCLTSLPPQVLKHDKVRFFFSTSSAPQL
PASTNLSCLLQYRGASRPICGVASIQPVLSIHTPLQQSSPSHLPPLPPQTAVTILPGAPV
PINDANSPQTHLSNPAAQPQQPSPEQNGILDWLRKLRLHKYYPVFKQLTMEEFLALTEED
LNKYDLTQGAKKKLKTQLELQKEKLEKRYVVSQFPVSCGGVARVMPSSHIGPLTHAHPGS
GSELRVDVENSSLPIPRDSSSSSGYSSAPSSPMTPLSRDTSFDRVKDPHRRLESGMDSGE
KERSCFLLNPAGPSRPTAQVLPVQNDPLLCASQMSLPPPSLPLLSPGRVLNCPRKPRPPP
LCPEERPKPVGSGVPVGVRLENIFPGLNLDGSQGHQDVPGPRGPLTVLRSPPGLMVETST
SLTSTSNTLHHVSHPPLHLQVSSSVPRTGSYLFSTPSSCLSSSSSTRPSFSSVSGVPIAT
ANSVPMAAVPGHTYCVNNTPTITPCSSPASTENSSYVSVQANSANSSSSLCVCSSCGCSG
NCGSYGALPASYTGYFPHPFSGTSVFTLGPLLHFSPLLTGSGTASPFSYPLVAPPIYNNS
LSHDSQQNLVLPPVQGFLGGGGAVYQPHGMMGNGSTGHKKTGNVSCYNCGLSGHHAQDCK
QPAMDSAQQGTFRLKYSPQSESQDSGD
Download sequence
Identical sequences A0A0R4IUM4
ENSDARP00000117645 ENSDARP00000117645 XP_001336526.4.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]