SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117769 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117769
Domain Number 1 Region: 112-176
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 3-50
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000262
Family BAR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117769   Gene: ENSDARG00000007302   Transcript: ENSDART00000144023
Sequence length 179
Comment pep:putative chromosome:Zv9:25:20020089:20025883:1 gene:ENSDARG00000007302 transcript:ENSDART00000144023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XERCMFNLLEKDVQRMQHLSGLLEAVIDYHRQSSQILENLRSNLQTKIRDASNKPKREFA
SKSVASTVCYSDIYGFSTCSSGPSSDAPVVVHRPEQVTIKTPTTDKPASINDRAPPLDQP
CCQALYSFQAENQGELGFKEGDIIILTSQIDENWYEGMIRGQSGLFPMNYVKVLVPLPQ
Download sequence
Identical sequences F1QYU2
ENSDARP00000117769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]