SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118082 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118082
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-29
Family Second domain of FERM 0.0003
Further Details:      
 
Domain Number 2 Region: 105-204
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-25
Family Third domain of FERM 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118082   Gene: ENSDARG00000075459   Transcript: ENSDART00000133774
Sequence length 205
Comment pep:novel chromosome:Zv9:13:31403686:31404612:1 gene:ENSDARG00000075459 transcript:ENSDART00000133774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHKHTRHQYYLQLRKDILEDRVHCNEETALFLAALALQAEFGDYMAEVYGKNYFQTEQYI
SKRVIEKVALPCLREELPRLHANNAQMLPEEAETEFLKIAQQLPEYGVLFHRVARERKPI
IGELVLGICAKGILVYEVKNNSRMLSRRFHWTETDSLSTSRRKFTIECSPSGKKHSFVTE
SSKIAQYLLNLCSAQHKFHSEMTSR
Download sequence
Identical sequences F1QBZ1
ENSDARP00000118082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]