SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118673 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118673
Domain Number 1 Region: 293-532
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-66
Family Nuclear receptor ligand-binding domain 0.0000000196
Further Details:      
 
Domain Number 2 Region: 163-243
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-26
Family Nuclear receptor 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118673   Gene: ENSDARG00000034181   Transcript: ENSDART00000131800
Sequence length 592
Comment pep:known chromosome:Zv9:13:37419899:37469856:1 gene:ENSDARG00000034181 transcript:ENSDART00000131800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSPGPAPVLDSSKADRGASPALLPRLYASPLGMDNQTVCIPSPYVEACQDYSPPHGGE
FNHGALTLYSPVSSAVLGFHRPPVSESLVPLSPTILWPPHSLHCPPPLAYSETRSHSAWE
EAKTHTLSQSSSVLSHTKLLGQQLEGDNGLNPSASIVGKGDTHFCAVCHDYASGYHYGVW
SCEGCKAFFKRSIQGHNDYICPATNQCTIDKSRRKSCQACRLRKCYEVGMMKCGVRRERC
SYRGARHRRNPQIRDSSGGVVGLRGQSQQHLEFPLSPSQHLFPSGGRAEGRGLNYSPEQL
VSCILEAEPPQIYLREPVKKPYTEASMMMSLTSLADKELVLMISWAKKIPGFVELTLSDQ
VHLLECCWLDILMLGLMWRSVDHPGKLIFTPDLKLNREEGNCVEGIMEIFDMLLATTSRF
RELKLQREEYVCLKAMILLNSNNCSSLPQTPEDVESRGKVLNLLDSVTDALVWIISRTGL
SSQQQSIRLAHLLMLLSHIRHLSNKGIEHLSNMKRKNVVLLYDLLLEMLDANTSQSSRML
EDRQQSPENLHTSRPQPDLKDSDQETPHSPRAEETVNKTLHSSLLREDMDTN
Download sequence
Identical sequences B8JJL3
ENSDARP00000063411 ENSDARP00000118673 XP_005157030.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]