SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120039 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120039
Domain Number 1 Region: 209-473
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-81
Family Protein kinases, catalytic subunit 0.00000000295
Further Details:      
 
Domain Number 2 Region: 99-241
Classification Level Classification E-value
Superfamily SH2 domain 5.95e-37
Family SH2 domain 0.0000116
Further Details:      
 
Domain Number 3 Region: 38-123
Classification Level Classification E-value
Superfamily SH3-domain 1.03e-19
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120039   Gene: ENSDARG00000007783   Transcript: ENSDART00000138028
Sequence length 485
Comment pep:known chromosome:Zv9:20:19247191:19269016:1 gene:ENSDARG00000007783 transcript:ENSDART00000138028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCACSDQNHPKGHEHYNSTNSKTSHASRDHKKQNNNQDEDVVIAQYDFQPASENDLQFK
KGDRLRIIKENGEWWLAKSLVTGYEGFIPSTYVARAQTLQVERWFFKDMNRRDTERLLLA
PGNKPGSFLVRESETTKGAFSLSIRDSTPEQGDVVKHYKIRALDNGGYYISPSTSFSSLQ
ELVKYYSRTADGLCQRLGNPCKSTAPQRPWAQDEWEIPRETLKLVKKLGAGQFGEVWMGF
YKNNQKVAIKTLKEGTMEPEAFLQEANLMKQLQHERLVKLHAVVTREPIYIVTEYMANGS
LLDFLKTDDGHKLKLSKLIDMTAQIAEGMAYIERKNYIHRDLRAANILVSETLHCKIADF
GLARIIETEYTAQEGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTYGRVPYPGM
TNPEVIRNLDRNYRMPCPDACPGELYDIMTKCWMEKPEDRPTFEYLQDTLNDFFIATEGQ
YEMQP
Download sequence
Identical sequences Q5TYU7
ENSDARP00000008826 ENSDARP00000120039 NP_001025391.1.45394 7955.ENSDARP00000008826 ENSDARP00000008826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]