SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120481 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120481
Domain Number 1 Region: 34-271,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-67
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 542-690
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-66
Family Ankyrin repeat 0.00000166
Further Details:      
 
Domain Number 3 Region: 419-536
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.24e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000823
Further Details:      
 
Domain Number 4 Region: 291-410
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-21
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 5 Region: 1056-1130
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000123
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120481   Gene: ENSDARG00000029463   Transcript: ENSDART00000144870
Sequence length 1132
Comment pep:novel chromosome:Zv9:2:31985773:32070821:-1 gene:ENSDARG00000029463 transcript:ENSDART00000144870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMPDQISVSEFLSETTEDYNSPTTSSFTTRLQSCRNTVNVLEEALDQDRTALQKVKKSVK
AIYNSGQEHVQNEENYGQALDKFGSNFISRDNSDLGTAFIKFSGLIKELAALLKNLLQSL
SHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEIT
GAEIAEEMEKERRIFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTAD
KLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEDSQSKQSGYSMHQLQG
NKEFGSEKKGYLFKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPVRLNLLTCQVKPSG
EDKKCFDLISHNRTYHFQAEDEQEFVIWISVLTNSKEEALNMAFRGEQSAGDDSLEDLTK
AIIEDVLRIPGNEVCCDCGAPEPKWLSTNLGILTCIECSGIHREMGVHISRIQSMELDKL
GTSELLLAKNVGNSSFNEILEGNLPSPSPKPAPSSDMTERKEYINAKYVEHRFARRTATT
ATARQGDLYEAVRTRDLMALIQLYADGVELMDPFPEAGQDPGETALHFAVRTSDQTSLHL
VDFLVQNSGTLDRQTESGNAALHYCCTYEKPECLKLLLRGKPSIDLVNQNGETALDIARR
LRNVQCEELLVEAAAGRFNPHVHVEYEWNLRLEEIDESDDDLDDKPSPVKKERSPRPQSF
CHSSSVSPQEKLTLPGYLGHRDKQRLSYGAFANPVYSTSTETPASPVSEGPTIASKTPAK
APSCGPPTSLPLGSQSSAGGSSTLSKKRAPPPPPGHKRTHSDPPSPVLQGPQSKGSESTP
PSANRTSPANKFEGIQQQQSTTSMNTKATFGPRVLPKLPQKVALRKIDTIHLPSVDKSGP
DVLQKPPQAQDAPPTRASDTITRPTEPPPKIPQVAERSQPVDVPQKPHISDLPPKPQLSD
LPPKPQLSDLPPKPQLSDLPPKPQLKDLPPKPQISDLPSKPAVCSASEATQRQSTQEETS
PKPQLTETQSFSQQEELSPRQASEDTNGAPAGALEMPVPMPRKINTVAKNKAKRVKTIYD
CQADNDDELTFVEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPMSFVHILSD
Download sequence
Identical sequences F1QBI5
ENSDARP00000120481 ENSDARP00000120481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]