SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120738 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120738
Domain Number 1 Region: 24-409
Classification Level Classification E-value
Superfamily L domain-like 6.46e-63
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 531-628
Classification Level Classification E-value
Superfamily Immunoglobulin 7.11e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 618-712
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 429-533
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-18
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120738   Gene: ENSDARG00000078561   Transcript: ENSDART00000141986
Sequence length 1018
Comment pep:novel chromosome:Zv9:6:47750344:47781054:-1 gene:ENSDARG00000078561 transcript:ENSDART00000141986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCSCSGGPGAAQLLDCNRKRLTAAALEAPAWVTHASINQNELTAVPFLGDASSNITVLSL
VHNRISEVVAEQLLPYSSLESLDLSSNSISELKAGSFPPMQLKYLNLSKNKISSLEPGCF
GNISSLLVLKINQNRLSLLPDKVFTLSQLQVLELRRNRIRVVESLIFKELKALKSLKMQR
NGITKLMDGALFGLENMEELELEYNNLTELNKGWLYGLHMLRILRVNQNNIGLIRADAWE
FCHRLEELDLSFNHLSRLEDWVFAGLSLLQSLNLGDNQISHLGEGVFSSLANVRTLDIRN
NEISLAIEDFIGMFVGLKRLNSLVLQNNKIRTITKRAFEGLMELENLDLSKNGIMSIHPD
AFTHLKLKTLDLNSSSLLCDCQLQWLGQWLINSRFQQSCTAVCAHPASLAGSSVLAVKPE
EFVCSDFPKPQITAHPKTAVALRGTNVTLNCSAFSSSDSPMSTAWRKDGEVLYEAQVQNY
ARYQDQRLLYTTILHLLNVNFTDEGQYQCVLSNHFGSNYSTLAKLTVNELPTFLKTPMDL
TIRTGTVARLECAAEGHPTPQIAWQKDGGINFPAARERRMHVMPDDDTFFIANVKAEDMG
VYSCTAKNEAGSLSANATLTVLETPSFQRPLEDRNVARGETAVLQCIARGSPAPRLNWTK
DDAPLVLTERHFFAAANQLLIIVDAGPADAGKYTCIMSNTLGTERGHIYLSVSPSANCDP
GSSVYGHDGWTTVGIVVMVVVCCVVGTSLVWVIVIYHMRRKSEDYSITNTDEMNLPADIP
SYLSSQGTLSEPQEGYSNSENGSHQQLMPSHANGYIHKGTDGVCYGEVSSDVDPDANGML
GSRVGSFFAGHNSFHRSEPREGQSNIPNGGAGALVICSDCYDNANIYSRTREYCPYAYLT
EDDPLVAQISRDGPQERDQHSENSDAVLESFINQQNASVFLSNHEPRLSASQHYSTDIPG
RSFWDAEDTHSSILAQGSVTVHNSPVCPSTGDDREERRGALEEPSYRTNPQESTSAPT
Download sequence
Identical sequences F1QKZ8
ENSDARP00000120738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]