SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121985 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121985
Domain Number 1 Region: 395-592
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0031
Further Details:      
 
Domain Number 2 Region: 568-678
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.29e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121985   Gene: ENSDARG00000003520   Transcript: ENSDART00000133420
Sequence length 711
Comment pep:novel chromosome:Zv9:7:41072670:41094958:1 gene:ENSDARG00000003520 transcript:ENSDART00000133420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEHSTNESNINTHNNDGPEVSSFSNSSLNQCLPISSKPLTQNNVDHHVPSDTQPPNV
SLSCKSFTSFNGTCEEDRSSLGSQDSGIPTLEINPPEHIHARVTIAELVVPPPHDDNPAT
LNLDISDGSLLKSSTFPRCDFDLVRHYGPSGLSSAAGKGTLNRSDDISVCSVSSLSTEFS
TTLSVSNEDFLDFMVTSESSAVVTFENEDVLHRFDSSLSAPIDLHGKLSSPQRQPVGVSG
AHEARPKRLGPLASFFNRGLFAKRMKDTGALEGQREPGWKLFGKVPHKDLPTKDSRKLQK
EYERRSGHTSNSTSPKKNVRKNLDFEPLSTTALILENRPANLPAKPEEEAQKHRQQYEEM
VAQAKKRELKDAQKRKKQLEDRCKLEESIGNAALTWSQEILPNWQSMCSSKRVRDLWWQG
LPPSVRGKVWSLAIGNELNITDELYDICLARAKEKWNAFVAPTAAVETESEDAGLSHADR
EASLELIKLDISRTFPNLCIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLIL
NLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYFAAFEVFFEENLPKLFAHFKNNNLSS
DIYLIDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTALGILRLYEDILTHMDFIHIA
QFLTRLPDYISAEEIFSSITTINMNSKNKKWPQVLQALQKGQDRGSPLLKR
Download sequence
Identical sequences E7F9B3
XP_005166496.1.45394 XP_683181.1.45394 ENSDARP00000040945 ENSDARP00000121985 ENSDARP00000040945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]