SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122114 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122114
Domain Number 1 Region: 261-397
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.5e-42
Family Synaptotagmin-like (S variant) 0.0000023
Further Details:      
 
Domain Number 2 Region: 123-252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.59e-42
Family Synaptotagmin-like (S variant) 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122114   Gene: ENSDARG00000037941   Transcript: ENSDART00000133035
Sequence length 410
Comment pep:known chromosome:Zv9:3:32279358:32288143:1 gene:ENSDARG00000037941 transcript:ENSDART00000133035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLASMQHRGRRAAESEEEPNRAPPPLPPPSHHSHNFVNMKNKFFNELGHLPNHKIRMPM
WAIGAIIVVVLALVGCFAFCIYKKCLGGKKKTKKVRERKGGRRRMKKEGEEEAGEEQPKE
GEGEGEKEYYGKLEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKK
FETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDL
GQPIHEYKDLVGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFV
KIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDP
IGKCWIGFGASGVGLRHWSDMLANPRRPVAQWHTLQPEEEVDAALKAPIR
Download sequence
Identical sequences F1QX49
ENSDARP00000122114 ENSDARP00000122114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]