SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122242 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122242
Domain Number 1 Region: 434-527
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.41e-17
Family Tudor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 306-383
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122242   Gene: ENSDARG00000089802   Transcript: ENSDART00000136554
Sequence length 596
Comment pep:novel chromosome:Zv9:10:38734065:38748450:1 gene:ENSDARG00000089802 transcript:ENSDART00000136554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLVRPLVSVTVLTLLGWCWYSFRRRRKIKASLWTEEEKCLLDGSSPVQFSPTDNGVLG
QSDLKMNQNISRSPEITELTDTSPFVEMHKFTSTSPVIGLNERVRPEPEGEVSIRFPETN
QSKKEKDDFTGEVHEDDFTDDKDGSSLSDFSPEQSQENMEIISSVLVQQVIHTTENQHSS
DPLSRPPNSGFQSASQDLVQHQSISGDDNDRETGSFRKKLLSDLGASVGDDSGCNSSFSE
DVSGSEGLTCEISEEEQSFLMTESDTTSIDGKMIPSILGEGEEEAWHGSGVESCIVADTQ
MSSLAPPPSPPIIQWDIEVPTHLVGRLIGKQGKFMNFLKQSSGAKIYVSTLPFTHDIQIC
HIQGSQQQVDEALSLVRKKFKDLDLSNCAPLPCLPITSWLLLPQDVFVEVMVSRVEAAHH
LFVHQHSHPSHQVLPTLIQAMQLCYSQPGCPSLPTPVEVGVVCAAPVTGSGWQRAQVIQY
DGETGTTHIRYVDSGGYDTVNSTTLRQIRSDFVTLPFQAAEVLLDNIMPLPGDEEFSLEA
KEALEESTANVALILKVTGSQDGLPLVHLWKQAGDEMVLINRSLADQGFFSWFDTQ
Download sequence
Identical sequences E7FBS7
XP_001342303.3.45394 ENSDARP00000106494 ENSDARP00000106494 ENSDARP00000122242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]