SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123888 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123888
Domain Number 1 Region: 258-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.6e-84
Family Protein kinases, catalytic subunit 0.000000000518
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-40
Family SH2 domain 0.00000264
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-27
Family SH3-domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123888   Gene: ENSDARG00000011370   Transcript: ENSDART00000150232
Sequence length 537
Comment pep:known chromosome:Zv9:17:15344203:15369836:-1 gene:ENSDARG00000011370 transcript:ENSDART00000150232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTDERETSVSQHAGYRYGSDPTPQHYPSFGVTAIPNYNNFHAPVSQG
VTVFGGVNSSSHSGTLRSRGGTGVTLFVALYDYEARSEDDLSFRKGEKFQILNSTEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESET
TKGAYSLSIQDWDETKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVHHYSARAAGLCC
RLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKT
LKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
GLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPSSLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences Q6EWH2
NP_001315092.1.45394 ENSDARP00000123888 7955.ENSDARP00000003208 ENSDARP00000123888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]