SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124002 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000124002
Domain Number 1 Region: 231-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-62
Family Nuclear receptor ligand-binding domain 0.000000295
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.5e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124002   Gene: ENSDARG00000087195   Transcript: ENSDART00000149097
Sequence length 479
Comment pep:known_by_projection chromosome:Zv9:16:19977008:20150570:1 gene:ENSDARG00000087195 transcript:ENSDART00000149097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQIEVIPCKICGDKSSGVHYGVITCEGCKGFFRRSQSSSVQYSCSRQSNCPIDRASRN
RCQSCRLKKCVAQGMSRDAVKFGRMSKRQRDSLFAEVERHRQHQRLQANSVQEPQPLQAY
RSSKDTREQPSHLIPPLPAAYPFSVEPELAGCPAEVIPYLDCHIVEAQTQGLAYRVPLRR
GENNSLSAGRGFESTRSTPESILNMTGSEMGFHPFDPESSFFSYPTSLQTEELAASIIRS
HKETTQYRLEELQALRWKVFSREEVHIYQSKPVDEMWQYCAVRLSDAVQYVVEFAKRIPG
FRQLCQNDQIALLKSGSMEVVLVRMTRMFNTANNTVFFDGKYAGTELFKSLACSDLIAAV
FEFANNLCALRLNEQQMAVFTAMILINPDRPCLEDRERVQRVRTEVELALRHILHRDNQE
SLLQKLYQRVPVLRSMCALHIEKLQWFRQLYPLTVHSLFPPLYKELFGSDADIHSLTTH
Download sequence
Identical sequences F8W3X2
ENSDARP00000124002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]