SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124004 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000124004
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00662
Family Tudor domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124004   Gene: ENSDARG00000077810   Transcript: ENSDART00000149878
Sequence length 1066
Comment pep:novel chromosome:Zv9:23:43852809:43860436:1 gene:ENSDARG00000077810 transcript:ENSDART00000149878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQLSGSNRLYSAYVKEVSPDNGPVTVFIEELNKQQTVPLLNLRLPSEEPQSWHTVSERGK
RQAAPNNGAQIPSEWESRGGRRPNRMQSQSAPSVRVHKQHSWPPQATTDDARNKFRRSDQ
RSSPVCILPEEEEESVVLELLHKDEHNFPSLGPSPQTATPGEVIKKGGEKKSHRKKEQKE
NFMETEASQKPLQRQKSGTEEKHGIKFSEEPRQRSSSTINEKLQEKPIPVAASPPSPAIF
LSGPKTPISSSNSATSPDPNRSAPEAVKKATIQPKSSPAQNPDNSHLEPVSTLASLQHIS
RVAPVSETTPASQFISGAAPVSVVPPASQSISATTPAPQSISAAAPVSVSTPASDSILVA
APDSATTPASQYIPGSRAVSVSTPAPQSISGATAVSSNTPTPHSISRATAVSVTAPAPHF
TFVATAESISTPSPHSISGATAVATPAPIQSAPALNSTKPSFQMAQLPTVELLPRTEAPS
QFTSVELVASQITLVPLPTSTPTQTTLAPTCPIPAAPVESSLCIQTLPPANTSTLSPTPS
STIPISAQAQVATPVLDSPGLSSTPHPIHANNAPPIPKKTVDPQTTMMPVPLPHAAPTSI
SPSIGSANASPPDLPLVSPKESVPSACETSTIPASGAAPVVDHPSQPQHLPFPQVQWSQL
LQDPVYPGFPQNEKGQLEPPPPFSYSQKGEDLPKDISVLKFFFNLGVKAYTQPMFPPIVY
LAPLNQAYLRGPSPSSDSPANPTITSWQPENPSSQPQSLSSMVDTPLDSHAPIAPVAAGS
SPVDPIEVRGYNDPPSIPMHVPPRPPMPWSAPSVSSAYPGGYPTTPPVQFSTPPYPPPGN
QMYPPSSVGYHRMPFPPMPLEAINHGPHGPIDVLPFARPTLERGQENGQLSINPQFRSVQ
NSAGFPGGQPHFLSGVDFKSVDTPVSLGGMEPPPYGGHCSVPSFQIGPLQGDMSGLIPLP
NGSLGRQGGAFPKNLHAEDSSRLVHTFSPEEKWPEEMESTNVDLRVPQLYYSHSYRGGGR
RGQEDRGGYRGRSQRGRKDYIGRGRQDDQSYRHYGRRGAGPQLPYQ
Download sequence
Identical sequences F8W3X0
ENSDARP00000124004 ENSDARP00000124004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]