SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124074 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000124074
Domain Number 1 Region: 14-245
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.95e-65
Family Nuclear receptor ligand-binding domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124074   Gene: ENSDARG00000044685   Transcript: ENSDART00000149795
Sequence length 248
Comment pep:known chromosome:Zv9:16:58399649:58404669:1 gene:ENSDARG00000044685 transcript:ENSDART00000149795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGCDCADFAQPNAILFNILSRGEFSYKRVPQTCHCEKRRRVCLQTPSETCALASDVLV
KTVYFMKNLPAFQQLPPKDQLKLLQNCWTPLFILGLAQDRVHFQVDESAAPSMLKRILLS
GQESAGADSEQPTLAGVQTLKSCINKFWSLDLSPKEYAYLKGTVIFNPDVPDLKASLFVE
GLQYEAQQALKEVLVPLYPQDGGRFARILLTASTLKSITPSLITELFFRPVIGDAQILDL
LADMLFSR
Download sequence
Identical sequences F8W3I2
ENSDARP00000124074 NP_001243120.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]