SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124850 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000124850
Domain Number 1 Region: 198-447
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-70
Family Nuclear receptor ligand-binding domain 0.000000000855
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124850   Gene: ENSDARG00000031768   Transcript: ENSDART00000148537
Sequence length 458
Comment pep:known chromosome:Zv9:25:34986538:35016527:1 gene:ENSDARG00000031768 transcript:ENSDART00000148537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQKNCLIDRTSRNRC
QHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQRDHQQQPGEAEPLTPT
YGLSTNGLTELHDDLSGYMNGHTPDGTKPDSGVSSFYLDIQPSPDQSGLDINGIKPEPIC
DFTPGSGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHMETCQYLREELQQMTWQAFLQ
EEVENYQSKPREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVF
VRMCRAFDPQNNTVYFDGKYAGPDVFKSLGCDDLISSVFEFGKNLCSMHLSEDEIALFSA
FVLMSADRSWLQEKVKVEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCSRHT
EKLTAFKAIYPDIVRAHFPPLYKELFGSDFEQSMPVDG
Download sequence
Identical sequences F8W254
ENSDARP00000124850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]