SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124901 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000124901
Domain Number 1 Region: 225-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-83
Family Protein kinases, catalytic subunit 0.00000000162
Further Details:      
 
Domain Number 2 Region: 115-257
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-38
Family SH2 domain 0.00000844
Further Details:      
 
Domain Number 3 Region: 56-165
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-22
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124901   Gene: ENSDARG00000059282   Transcript: ENSDART00000148860
Sequence length 503
Comment pep:known chromosome:Zv9:17:25134654:25172285:-1 gene:ENSDARG00000059282 transcript:ENSDART00000148860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCGSFDPDDEFSYHPDEWCDQCNCPKPPVSQNFDPLIPYPSQYTPPPSSPLPENLVVA
IYKYDPAHSDDLGFEKGEKMKILDCDDPEWYMAESLFTGQRGYIPKNFVAKLNSMETEPW
FYKNLSRNDAMRQLLAPGNTQGSFLIRESETQPGSFSISVRDLDPMQGDIIKHYRIRNMD
AGGFYITNKISFNSLSELVKHYSREADGLCTRLVKPCQTRAPQKPWWQDEWEVPRESLKL
ERRLGQGQFGEVWMGLYNNNRQVAIKSLKPGTMSISAFLAEANLMKSLQHPRLVRLFAVV
TQEPIYIITEYMENGSLVDFLKTPEGSDIPINTLIDMAAQVAEGMAYVEQKNYIHRDLRA
ANILVSHELTCKIADFGLARLIENNEYTAREGAKFPIKWTAPEAINYGTFSIKSDVWSFG
VLLTEIVTYGRIPYPGMTNPEVIANLERGYRMPCPDNCPEALYNVMKHCWTENPDNRPTF
EFLRSVLEDFFTATEGQYQEQPC
Download sequence
Identical sequences Q1RLY5
ENSDARP00000076792 ENSDARP00000096251 ENSDARP00000110287 ENSDARP00000124901 NP_001035418.1.45394 7955.ENSDARP00000076792 ENSDARP00000076792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]