SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126507 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126507
Domain Number 1 Region: 135-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-63
Family Nuclear receptor ligand-binding domain 0.0000000596
Further Details:      
 
Domain Number 2 Region: 12-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-26
Family Nuclear receptor 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126507   Gene: ENSDARG00000037025   Transcript: ENSDART00000151986
Sequence length 383
Comment pep:known chromosome:Zv9:1:36643724:36709077:-1 gene:ENSDARG00000037025 transcript:ENSDART00000151986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XASLRHTSSTAKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRVRKCLQAGMNLGARKSKKLGKIKSISEDSSLQSSKDGPFLTSEKELSSST
ALVPHTPTVAPYLTPSVCSVLELIEPEVVFAGYDNTQPDTTDHLLTSLNQLAGKQMIRVV
KWAKVLPGFRSLPIEDQITLIQYSWMCLSSFSLSWRSYKHTNAQMLYFAPDLVFNEERMQ
QSAMYDLCVGMRQVSQEFVRLQLTYEEYLAMKVLLLLSTVPKDGLKNQGAFEEMRVNYIK
ELRRSVGKATNNSGQTWQRFFQLTKLLDATHDLVRSLLDFCFYTFRESQALKVEFPEMLV
EIISDQIPKVESGQTHTLYFHKK
Download sequence
Identical sequences A0A0R4ICJ8
ENSDARP00000126507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]