SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000128484 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000128484
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000628
Family Ypt/Rab-GAP domain of gyp1p 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000128484   Gene: ENSDARG00000069339   Transcript: ENSDART00000155346
Sequence length 606
Comment pep:known_by_projection chromosome:Zv9:24:40705317:40731100:1 gene:ENSDARG00000069339 transcript:ENSDART00000155346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIQSQICPLPDRQSKANQLEQNGRLVPLILSSVQRVRSEVMAGDCGVFVDWSQMGDVSR
DAAPGKTEYKDLKELKQHARSGQWAKNHSQRSAVYQHLLKALPCRTVTPDAEVYRDIVGN
STSKRNPSAYPLPEFVDGTAVPQYCLKAESIGSVHAVISCVAGQFPDISHCPSLPAVTAL
MMHWSPDEAQCFESVSRMLACNEPGRRLLDQTFLAYESACMTFGDLVHKYCPAAHKLMVA
TATDVLEVYSDWQRWVFGDLPFSFAARVLDVFLVEGYKVLYRVALAILKFYRKQFVASNS
APSKQDSAAVRRDIQTFVQSIGKSVTPDKLLEKAFSIRLFSRKEITLLQLANEKSLQQKG
ITVKQKRQNVQLAVNADNFSSEIVSAKEIRDIWSWIPERFALCQPQLLFTTSTHGCSLNR
FYAHCEGYEPTLLLIRTTDREVCGAFLSTDWEERKRGGNKLSFFGTGECFVFRMKPEMER
YEWVIIKHPELAKSAQSAEDQSSVEDNGTPHSGETLEKPTTDSSHLSPFLSARHFNLNSR
NTSMFMAGNVDSIIIGGGDGNALYIDSELNHGRTERCLTFDNPPLCAESFQVALLEVWGF
KDAMGS
Download sequence
Identical sequences E7FCR8
ENSDARP00000106395 XP_003201409.4.45394 ENSDARP00000106395 ENSDARP00000128484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]