SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000128686 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000128686
Domain Number 1 Region: 2-22,60-123
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.2e-21
Family BAR domain 0.022
Further Details:      
 
Domain Number 2 Region: 146-190
Classification Level Classification E-value
Superfamily SH3-domain 0.00000761
Family SH3-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000128686   Gene: ENSDARG00000008983   Transcript: ENSDART00000154529
Sequence length 197
Comment pep:putative chromosome:Zv9:8:2951565:2965266:1 gene:ENSDARG00000008983 transcript:ENSDART00000154529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERRLLENRRLDLDACKARLKKAKAAEAKAAAVPDFQETRPRNYVLSASASALWSEELDK
SEQELRVAQAEFDRQAEVTRLLLEGISSTHVNHLRCLREFAEAQAMYYNQCHKYMQELQR
ELGRCPDSLEVNCEPSGSPSDLLNSPSPLDSDTLQIEEVQPPASGTRKARVLYDYTAADS
SELSLRADEVRATNDVT
Download sequence
Identical sequences X1WEN5
ENSDARP00000128686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]