SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000129215 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000129215
Domain Number 1 Region: 162-254
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.42e-22
Family Synaptotagmin-like (S variant) 0.0069
Further Details:      
 
Domain Number 2 Region: 23-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-21
Family PLC-like (P variant) 0.057
Further Details:      
 
Domain Number 3 Region: 304-507
Classification Level Classification E-value
Superfamily vWA-like 1.23e-20
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000129215   Gene: ENSDARG00000037084   Transcript: ENSDART00000155249
Sequence length 559
Comment pep:known_by_projection chromosome:Zv9:7:69540786:69648797:1 gene:ENSDARG00000037084 transcript:ENSDART00000155249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSQEATSPVAGIGGPAACVCKVELRVSCKSLLDRDTLNKSDPCVILMVQNQGQWTELD
RTEVIKSNLNPVFAKVLMLDYYFEEVQKLRFEVYDIHGAHSIGTRDDDFLGGVECTLGQI
VAQKKMMKPLLLKYGKYAGKSTITIHAEEISGNNGYVELSFCAKKLDDKDLFSKSDPFLE
IYRINDDGTEQLVHRTEVIKNNLNPVWEPFKVSLISLCSCDDERKLKCLVWDYDSRGKHD
FIGEFYTNFKEMQKISSGNKVTWECINPKYKLKKKNYKNSGLVILSDLKLHRVYSFLDYI
MGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKALIAVGEICQDYDSDKRFSA
LGFGARIPPNYEVSHDFAINFNPEDDECEEIQGVVEAYQNCLPKIQLYGPTNVAPIINRI
AKQAAGKEPIKDASLYHILLILTDGVVTDMADTREAIVRASYQPMSIIIVGVGNADFTDM
QILDGDDGVLRSPKGEPVLRDIVQFVPFRDFKTASPAALAKCVLAEVPKQVVEYFSHKAI
PPMNPVLNSSPNSIANTPE
Download sequence
Identical sequences E7F725
ENSDARP00000085485 ENSDARP00000129215 ENSDARP00000085485 XP_692981.4.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]