SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000129737 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000129737
Domain Number 1 Region: 213-483
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-83
Family Protein kinases, catalytic subunit 0.000000218
Further Details:      
 
Domain Number 2 Region: 112-247
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-36
Family SH2 domain 0.00031
Further Details:      
 
Domain Number 3 Region: 42-162
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000144
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000129737   Gene: ENSDARG00000077783   Transcript: ENSDART00000155808
Sequence length 492
Comment pep:known_by_projection chromosome:Zv9:23:17524872:17555967:1 gene:ENSDARG00000077783 transcript:ENSDART00000155808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METCCRCCMPCLKRLWDSIWPENYPNLHRPDDIRTVSGDIRVPAPKKKPAQLYAALFDFV
ARSEEELSVKEGDKLSVIEKRGDYVFAKKLTGSLESGLIPANYVALLKDEFANYKWYYGN
INRQKAEKLLLSSENKTGSFLVRISESHSDEYTISARSENSVFHFRIHRSPIGAYFVSEK
ISFGTLDELIRYYQQNSRSLGCHIDQPCVQRRELFDMEPWERPREEFMLVKKLGEGHFGE
VWEAIWKTQKKKVAIKMLKQEDTKLDEFVKEVHALKNLHHPKLIELLALCSRGEPVYIVT
ELMAKGSLKSYLSSAEGQLLTSAHLIYMAAQIAEGMAYLEDRHIVHRDLAARNILVGNDL
VCKVADFGLARIIKDSVFTASKTTKIPVRWTAPEAALYQRFSVKSDVWSFGVLLYEMMSR
GKMPYDGKTNKEVMEALSSGYRLACPNHCPPNIYRIMLECWNNEASKRPSFHALHSQLDN
IYSRLYFKTIEV
Download sequence
Identical sequences X1WHM4
NP_001129722.2.45394 ENSDARP00000129737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]