SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 12asA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  12asA
Domain Number 1 Region: 8-324
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.33e-217
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 12asA   PDB: 12as   SUPERFAMILY: 12asA
Sequence length 330
Comment (A:)
Sequence
mktayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvk
alpdaqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwe
rvmgdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdl
dakgreraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwn
pvledafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrl
tmlllqlphigqvqagvwpaavresvpsll
Download sequence
Identical sequences cath|current|11asA00/4-330 cath|current|11asB00/4-330 cath|current|12asA00/4-330 cath|current|12asB00/4-330 11as_A 11as_B 12as_A 12as_B 12asA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]